Announcement

Collapse
1 of 2 < >

New structure

We have optimized the structure of this area, and new subforums have been added: Forum Games, Creativity, and GamersHood Planet.

If you can't find your favorite threads, get an overview here:

http://gamershood.com/forum/forumdisplay.php?f=32
2 of 2 < >

Rules updated

Old members and new members, please read the updated rules.
You find them as sticky at the top of all forum categories, for example here:
http://gamershood.com/forum/showthread.php?t=1603
Thank you for taking a couple of minutes to do that.

The moderation team
See more
See less

Words

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • #76
    My word of the day "bored"
    Life is not a problem to be solved, but a mystery to be lived
    "The best way to cheer yourself up is to try to cheer somebody else up."

    Comment


    • #77
      Krungthepmahanakonbowornratanakosinmahintarayudyay amahadiloponoparatanarajthaniburiromudomrajniwesma hasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit

      This is the name of a place in Bangkok...I think it's in thai, but it sure is loooooong

      And this is the English translation
      The land of angels the great city of immortality various of devine gems the great angelic land unconquerable land of nine noble gems the royal city the pleasant capital place of the grand royal palace forever land of angels and reincarnated spirits predestined and created by the highest devas.


      The unspecifically shaped member of the Looney Bin

      Comment


      • #78
        SmileS Is the longest word!
        Because there is a mile between the two s's

        Comment


        • #79
          found this one here...http://fun-with-words.com/word_longest.html
          ACETYL&#173;SERYL&#173;TYROSYL&#173;SERYL&#173;ISO &#173;LEUCYL&#173;THREONYL&#173;SERYL&#173;PROLYL& #173;SERYL&#173;GLUTAMINYL&#173;PHENYL&#173;ALANYL &#173;VALYL&#173;PHENYL&#173;ALANYL&#173;LEUCYL&#1 73;SERYL&#173;SERYL&#173;VALYL&#173;TRYPTOPHYL&#17 3;ALANYL&#173;ASPARTYL&#173;PROLYL&#173;ISOLEUCYL& #173;GLUTAMYL&#173;LEUCYL&#173;LEUCYL&#173;ASPARAG INYL&#173;VALYL&#173;CYSTEINYL&#173;THREONYL&#173; SERYL&#173;SERYL&#173;LEUCYL&#173;GLYCYL&#173;ASPA RAGINYL&#173;GLUTAMINYL&#173;PHENYL&#173;ALANYL&#1 73;GLUTAMINYL&#173;THREONYL&#173;GLUTAMINYL&#173;G LUTAMINYL&#173;ALANYL&#173;ARGINYL&#173;THREONYL&# 173;THREONYL&#173;GLUTAMINYL&#173;VALYL&#173;GLUTA MINYL&#173;GLUTAMINYL&#173;PHENYL&#173;ALANYL&#173 ;SERYL&#173;GLUTAMINYL&#173;VALYL&#173;TRYPTOPHYL& #173;LYSYL&#173;PROLYL&#173;PHENYL&#173;ALANYL&#17 3;PROLYL&#173;GLUTAMINYL&#173;SERYL&#173;THREONYL& #173;VALYL&#173;ARGINYL&#173;PHENYL&#173;ALANYL&#1 73;PROLYL&#173;GLYCYL&#173;ASPARTYL&#173;VALYL&#17 3;TYROSYL&#173;LYSYL&#173;VALYL&#173;TYROSYL&#173; ARGINYL&#173;TYROSYL&#173;ASPARAGINYL&#173;ALANYL& #173;VALYL&#173;LEUCYL&#173;ASPARTYL&#173;PROLYL&# 173;LEUCYL&#173;ISOLEUCYL&#173;THREONYL&#173;ALANY L&#173;LEUCYL&#173;LEUCYL&#173;GLYCYL&#173;THREONY L&#173;PHENYL&#173;ALANYL&#173;ASPARTYL&#173;THREO NYL&#173;ARGINYL&#173;ASPARAGINYL&#173;ARGINYL&#17 3;ISOLEUCYL&#173;ISOLEUCYL&#173;GLUTAMYL&#173;VALY L&#173;GLUTAMYL&#173;ASPARAGINYL&#173;GLUTAMINYL&# 173;GLUTAMINYL&#173;SERYL&#173;PROLYL&#173;THREONY L&#173;THREONYL&#173;ALANYL&#173;GLUTAMYL&#173;THR EONYL&#173;LEUCYL&#173;ASPARTYL&#173;ALANYL&#173;T HREONYL&#173;ARGINYL&#173;ARGINYL&#173;VALYL&#173; ASPARTYL&#173;ASPARTYL&#173;ALANYL&#173;THREONYL&# 173;VALYL&#173;ALANYL&#173;ISOLEUCYL&#173;ARGINYL& #173;SERYL&#173;ALANYL&#173;ASPARAGINYL&#173;ISOLE UCYL&#173;ASPARAGINYL&#173;LEUCYL&#173;VALYL&#173; ASPARAGINYL&#173;GLUTAMYL&#173;LEUCYL&#173;VALYL&# 173;ARGINYL&#173;GLYCYL&#173;THREONYL&#173;GLYCYL& #173;LEUCYL&#173;TYROSYL&#173;ASPARAGINYL&#173;GLU TAMINYL&#173;ASPARAGINYL&#173;THREONYL&#173;PHENYL &#173;ALANYL&#173;GLUTAMYL&#173;SERYL&#173;METHION YL&#173;SERYL&#173;GLYCYL&#173;LEUCYL&#173;VALYL&# 173;TRYPTOPHYL&#173;THREONYL&#173;SERYL&#173;ALANY L&#173;PROLYL&#173;ALANYL&#173;SERINE = Tobacco Mosaic Virus, Dahlemense Strain.
          Once a pirate...

          Related to the Loonie Crew!!!
          I am an elite member of GFARDTO

          And supporter of its subunit UPMGPC
          Also the referee of GH Looney Bin!!!
          1

          Comment


          • #80
            FLOCCI&#173;NAUCINI&#173;HILIPIL&#173;IFICATION = an estimation of something as worthless
            sigpic

            Comment


            • #81
              Lol that's a long one murph!

              Comment


              • #82
                my fav word today is entidissenstablishmenteniterieliziam= THE LONGEST WORD!
                Online family:
                Online bro: Point click man
                Online dad:RC-10M
                Online sis in law:Ratgirl

                Comment


                • #83
                  And here's my word of the day
                  Callipygian - Someone who makes bad jokes.

                  Comment


                  • #84
                    Well no matter how long you word is. Bookkeeper is the only word with 3 double letters (together in a row) in the English Lauguage.
                    Life is not a problem to be solved, but a mystery to be lived
                    "The best way to cheer yourself up is to try to cheer somebody else up."

                    Comment


                    • #85
                      Really? Cool!
                      But... Sweettoothed?

                      Comment


                      • #86
                        Thats not One Word it's two Sweet Tooth.
                        Life is not a problem to be solved, but a mystery to be lived
                        "The best way to cheer yourself up is to try to cheer somebody else up."

                        Comment


                        • #87
                          My fav word at the moment is onomatopoeia which, for anyone who doesn't know, means "The formation or use of words such as buzz or murmur that imitate the sounds associated with the objects or actions they refer to."
                          Smile and the world smiles with you!
                          Frown and you'll look like a raisin!

                          I love this site!
                          And Gamershood

                          Comment


                          • #88
                            @Dark - Ok!

                            My word of the day = BALDERDASH

                            It means Senseless talk .

                            Comment


                            • #89
                              HEPATICOCHOLANGIOCHOLECYSTENTEROSTOMIES (39 letters; surgical creation of a connection between the gall bladder and a hepatic duct and between the intestine and the gall bladder) is the longest word in Gould's Medical Dictionary.

                              ~Tonks~
                              .Love.Explore.Laugh.Smile.Shop.Live.Rock.Flirt.Discorve.Accelerate.Express.Challange

                              Comment


                              • #90
                                "forty" is the only number with its letters in alphabetical order.. and "one" is the only number with the letters in reverse alphabetical order


                                The unspecifically shaped member of the Looney Bin

                                Comment

                                Working...
                                X